Euro Gen IGF1 LR3, 1mg

Euro Gen IGF1 LR3, 1mg

Euro-Gen

Research-use-only peptide; insulin-like growth factor analogue
  • Express Peptides states that its peptides, including Euro Gen Branded products, are manufactured in the United Kingdom and that each peptide batch has a minimum purity of >99%, verified through independent third Party laboratory testing to confirm composition and purity
  • The company indicates that Certificates of Analysis (COAs) are available on request for each peptide batch, providing analytical documentation of identity, purity and related quality parameters; these COAs are not published online for Euro Gen IGF1 LR3, 1mg but are explicitly offered to customers upon request
  • Express Peptides describes strict temperature Controlled handling from production to dispatch to preserve peptide integrity, together with secure packaging aimed at maintaining product condition during shipping, and states adherence to high internal quality Control standards for research Grade products
  • No UK MHRA medicinal marketing authorisation (Product Licence), EMA European Public Assessment Report, FDA drug approval, or CE/UKCA medical device certification is listed for Euro Gen IGF1 LR3, 1mg; it is clearly presented as a research Use Only peptide reagent rather than a licensed medicinal product or regulated medical device
Synthetic insulin-like growth factor 1 (IGF-1) analogue peptide for in vitro and laboratory research

Description

Euro-Gen IGF1-LR3, 1mg is a research-grade peptide product supplied by Express Peptides under the Euro-Gen brand. It contains 1 mg of IGF-1 LR3 (Long R3 insulin-like growth factor 1), a synthetic analogue of human insulin-like growth factor 1 engineered to have a longer duration of action and increased potency compared to native IGF-1. The Express Peptides product summary describes IGF-1 LR3 as a synthetic form of Insulin-like Growth Factor 1 with an altered structure that allows it to remain active for longer, mimicking natural IGF-1 while being designed to be more potent and longer-acting. Research focuses on its potential to enhance muscle growth, improve recovery and aid in fat loss by promoting cellular growth and regeneration. The Euro-Gen IGF1-LR3, 1mg vial is marketed exclusively for in vitro testing and laboratory research, with prominent statements that it is for research use only, must not be introduced into humans or animals, and is not a drug, food or cosmetic. Express Peptides indicates that its peptides are manufactured in the UK to a minimum purity of greater than 99% and are subject to independent third-party laboratory testing, with Certificates of Analysis available on request.

Bnefits

  • Provides a defined 1 mg quantity of IGF-1 LR3, a well-characterised synthetic analogue of human insulin-like growth factor 1, for controlled in vitro and laboratory studies of IGF-1 receptor signalling and growth factor biology
  • Supports experimental research into mechanisms of muscle growth, recovery and tissue regeneration, as IGF-1 LR3 has been widely studied for its ability to stimulate cell proliferation, protein synthesis and anabolic signalling pathways in vitro and in preclinical models
  • Enables investigation of metabolic and body-composition related endpoints, as research literature describes IGF-1 LR3 as influencing fat metabolism and energy balance while promoting cellular growth and regeneration
  • Supplied by Express Peptides as a UK-manufactured peptide with a stated minimum purity of >99% and independent third-party laboratory testing, with Certificates of Analysis available on request to document batch-specific quality parameters
  • Delivered as a lyophilised (powder) peptide suitable for long-term frozen storage and subsequent reconstitution using appropriate solvents for experimental use
  • Marketed with clear labelling that it is for research use only, helping to ensure separation from medicinal use and emphasising that it must not be administered to humans or animals

Indications

  • Designated use on the Express Peptides product page: for research use only and exclusively for in vitro testing and laboratory research
  • Express Peptides states that any form of bodily introduction of this product into humans or animals is strictly prohibited by law and that it is not a drug, food, or cosmetic
  • Used in experimental and preclinical research (not as this specific commercial vial but as the same IGF-1 LR3 molecule) to investigate IGF-1 receptor signalling, cell proliferation, hypertrophy, and tissue regeneration
  • Used in research on muscle growth and repair, including studies of protein synthesis, myocyte hypertrophy, and recovery from injury or intensive training, as IGF-1 LR3 has been shown to exert potent anabolic effects in experimental systems
  • Employed as a tool compound in research into fat metabolism, body composition and metabolic regulation, where IGF-1 LR3 is investigated for its effects on lipolysis, insulin-like signalling and energy homeostasis
  • No approved clinical or therapeutic indications exist for Euro-Gen IGF1-LR3, 1mg; it is not licensed as a medicinal product or medical device

Composition

  • Active substance: IGF-1 LR3 (Long R3 insulin-like growth factor 1), a synthetic analogue of human insulin-like growth factor 1 (IGF-1)
  • IGF-1 LR3 is an 83-amino-acid single-chain polypeptide analogue of human IGF-1 that differs from native IGF-1 by having an arginine instead of glutamic acid at the third amino acid position ("arginine 3") and an additional 13 amino acids at the N-terminus, commonly described as the sequence MFPAMPLSSLFVNG followed by the native IGF-1 sequence
  • Representative amino acid sequence for human IGF-1 LR3 from recombinant protein datasheets: MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA (83 amino acids)
  • Commonly reported molecular formula for IGF-1 LR3 in research peptide catalogues: approximately C400H625N111O115S9, corresponding to a polypeptide of about 9.1–9.2 kDa molecular weight depending on exact counter-ion and hydration state
  • The Euro-Gen IGF1-LR3, 1mg product contains 1 mg of lyophilised IGF-1 LR3 peptide per vial as indicated by the product name; no excipients, stabilisers, preservatives or buffer components are specified in publicly available information for this specific product
  • Express Peptides states that all of its peptides have a minimum purity of >99% and undergo independent third-party laboratory testing, but lot-specific Certificate of Analysis data (such as exact purity percentage, residual solvents, and identity confirmation methods) for Euro-Gen IGF1-LR3, 1mg are not publicly listed and are available only on request

Formulation

  • Product type: research-grade synthetic polypeptide (IGF-1 LR3) supplied as a lyophilised powder
  • Strength: 1 mg of IGF-1 LR3 per Euro-Gen-branded vial
  • Physical form: lyophilised (powder) peptide; Express Peptides’ FAQ describes its products generally as lyophilised peptide powders intended for frozen storage and later reconstitution for research use
  • Chemical class: recombinant insulin-like growth factor 1 analogue (Long R3 IGF-1) and growth factor peptide acting as an agonist at the IGF-1 receptor
  • Typical appearance for IGF-1 LR3 research peptides in technical datasheets is a white to off-white lyophilised solid; the Euro-Gen product imagery shows a clear glass vial with white lyophilised material, though no formal appearance description is provided in text
  • No information is publicly listed regarding additional formulation components such as bulking agents, buffers, preservatives, or stabilisers for the Euro-Gen IGF1-LR3, 1mg vial

Packaging

  • Supplied as a single Euro-Gen-branded glass vial containing 1 mg of IGF-1 LR3 lyophilised peptide, as shown in the product imagery on Express Peptides and dermafillerltd.uk
  • The vial label displays the Euro-Gen branding and the product name "IGF1-LR3", together with research-use-only labelling and other basic identification text; detailed label wording beyond what is visible in product images is not provided in text format
  • The Dermafiller listing for Euro-Gen IGF1-LR3, 1mg presents the product as an individual vial sold at a retail price (often with discounted promotional pricing), but does not describe secondary packaging such as cartons or inserts
  • Express Peptides indicates in its FAQ and site information that products are shipped under strict temperature control with secure packaging to preserve peptide integrity, but no product-specific details are provided regarding vial glass type, stopper material, crimp seal, or tamper-evident features for this SKU
  • No additional pack sizes, multi-vial kits or alternative presentations are described for Euro-Gen IGF1-LR3, 1mg beyond the single 1 mg vial and a separate pre-mixed pen injector presentation listed as a distinct product

Usage

  • The Express Peptides product page for Euro-Gen IGF1-LR3, 1mg states that it is for research use only and exclusively designated for in vitro testing and laboratory research; it is not intended for human or animal use
  • The same page includes a prominent disclaimer that any form of bodily introduction of this product into humans or animals is strictly prohibited by law and that it is not a drug, food or cosmetic and must not be misrepresented, misused or mislabelled as such
  • Express Peptides states that the product is intended to be handled only by licensed and qualified professionals in appropriate research or laboratory environments
  • In its FAQ, Express Peptides explains that peptides can be reconstituted using a variety of solvents depending on their hydrophilic or hydrophobic properties and pH; common options mentioned include saline, bacteriostatic water and acetic acid, but no product-specific reconstitution volume, solvent choice or protocol is provided for Euro-Gen IGF1-LR3, 1mg
  • The FAQ advises that lyophilised peptides should be stored frozen (typically -20°C to -80°C) and that after reconstitution the peptide solution should be stored at 4°C and used within a few weeks, with efforts made to minimise storage time in solution and avoid repeated freeze–thaw cycles
  • Express Peptides provides a dosage calculator on its website to assist researchers with calculating experimental dosages for research, but no clinical dosing guidance, administration routes or therapeutic regimens are given, and the product is not authorised for therapeutic use
  • There are no instructions for clinical administration or treatment use; all guidance is restricted to research handling, storage and reconstitution considerations

Contraindications

  • Not a medical product

Adverse Effects

  • Not a medical product

Storage Conditions

  • Express Peptides’ FAQ states that lyophilised (powder) peptides should be stored at -20°C to -80°C with a shelf life of up to 2 years or more under these frozen conditions
  • The same FAQ provides a storage guidance table indicating that lyophilised peptide powder can be stored at room temperature (20–25°C) for approximately 1 month, in a refrigerator (2–8°C) for about 12 months, at -20°C for up to 48 months, and at -80°C for long-term storage
  • After reconstitution, Express Peptides recommends storing peptide solutions in a refrigerator at 2–8°C and using them within roughly 2 weeks to 2 months depending on conditions, and advises against repeated freeze–thaw cycles to maintain stability
  • The FAQ further advises that peptide vials should be kept capped, stored in a cool, dry place, away from light and moisture, and that once a vial cap is removed, immediate use is recommended with avoidance of storage after opening
  • For optimal stability, Express Peptides suggests storing peptides in dark conditions or in containers that protect them from light exposure; no different or additional storage requirements are specified for Euro-Gen IGF1-LR3, 1mg beyond these general peptide storage guidelines

Duration

Not a medical product

Onset

Not a medical product

Browse more Research-use-only peptide; insulin-like growth factor analogue